PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K03130.1.p
Common NameEUGRSUZ_K03130, LOC104426466
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 357aa    MW: 40753.6 Da    PI: 9.844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K03130.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-15453148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                      r+rW +eEd ll  +vkq+G++ W++++++m+  ++R +k+c +rw +yl
  Eucgr.K03130.1.p  4 RQRWRAEEDALLRAYVKQYGPREWHLVSQRMNtpLNRDAKSCLERWKNYL 53
                      89**********************************************97 PP

2Myb_DNA-binding36.21.4e-1159103147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +g+ ++eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Eucgr.K03130.1.p  59 KGSLSEEEQRLVIQLQAKHGNK-WKKIAAEIP-GRTAKRLGKWWEVF 103
                       57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.304157IPR017930Myb domain
SMARTSM007171.4E-13355IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-21498IPR009057Homeodomain-like
CDDcd001679.40E-9653No hitNo description
Gene3DG3DSA:1.10.10.604.3E-20660IPR009057Homeodomain-like
PfamPF139214.6E-14768No hitNo description
SMARTSM007175.1E-1058106IPR001005SANT/Myb domain
PROSITE profilePS5129418.5358108IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-1561102IPR009057Homeodomain-like
CDDcd001675.57E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MKERQRWRAE EDALLRAYVK QYGPREWHLV SQRMNTPLNR DAKSCLERWK NYLKPGIKKG  60
SLSEEEQRLV IQLQAKHGNK WKKIAAEIPG RTAKRLGKWW EVFKEKQQRE QKENKGALPI  120
DEGKYDHILE NFAEKLVKER STPALLMATA NGGFIHTDSP ALAPTLLPPW LSNSNGTPTL  180
RPPSPSVTLS LSPATVPASQ PIPWLQADRG LDSGSLSLTG LPNHGPLPTS GENILMSELA  240
ECCKELEEGH RAWAAHKKEA AWRLKRLELQ LESEKACRRR EKMEEIEAKI NTLREEQKAS  300
LDKIETEYRE QLAGLRKDAE SKEQKLAEQW TAKHVQLSKL IEQIGFRPRI ADHDRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-15792789MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-15792789C-Myb DNA-Binding Domain
1msf_C1e-15792789C-Myb DNA-Binding Domain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K03130.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037830.10.0PREDICTED: transcription factor AS1
RefseqXP_010037831.10.0PREDICTED: transcription factor AS1
RefseqXP_010037832.10.0PREDICTED: transcription factor AS1
RefseqXP_010037833.10.0PREDICTED: transcription factor AS1
SwissprotO809311e-160AS1_ARATH; Transcription factor AS1
TrEMBLA0A059A7870.0A0A059A787_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s08610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61862740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-137MYB family protein